Size：1
P1(RMB)：916
MW：3559.17
One letter sequence：WYKHVASPRYHTVGRASGLLMGLRRSPYLW
Molecular Formula：C165H249N49O38S
Description：This peptide was recently identified as the endogenous ligand for the two structurally related orphan G-protein-coupled receptors (GPCRs) GPR7 and GPR8 which are expressed in the central nervous system. NPW-30 activated and bound to both GPR7 and GPR8 at similar effective doses. Intracerebroventricular administration of NPW in rats resulted in an increased food intake and stimulation of prolactin release indicating that NPW acts as a mediator of the central control of feeding and the neuroendocrine system. \n
Literature Reference：Y.Shimomura et al., J. Biol. Chem., 277, 35826 (2002)\nS.Brezillon et al., J. Biol. Chem., 278, 776 (2003)\nH.Tanaka et al., Proc. Natl. Acad. Sci. USA, 100, 6251 (2003)\nY. Shimomura et al., J. Biol. Chem., 277, 35826 (2002)\nS. Brezillon et al., J. Biol. Chem., 278, 776 (2003)\nH. Tanaka et al., Proc. Natl. Acad. Sci. USA,100, 6251 (2003)\nM.S. Mondal et al., Endocrinology, 144, 4729 (2003)\nF. Takenoya et al., Regul. Pept., 145, 159 (2008)\n
Cas：383415-90-5