Size：1
P1(RMB)：994
MW：3717.12
One letter sequence：AAVTPEERHLSKMQQNGYENPTYKFFEQMQN
Molecular Formula：C162H243N45O52S2
Description：This peptide is the C-terminal fragment of amyloid precursor protein (APP) also known as C31. It is intracellularly generated by proteolytic cleavage of APP by caspases-8 and -9. C31 had a proapoptotic and a cytotoxic effect on neuronal cells and was shown to be present in brains of Alzheimer's disease (AD) patients. In cultured cells caspase cleavage of APP was induced by amyloid β-protein and the subsequent generation of C31 contributed to the apoptotic cell death associated with amyloid β-protein. Amyloid precursor binding protein BP1 (APP-BP1) a cell cycle protein which is increased in AD brain was demonstrated to bind to the C31 region of APP and to mediate APP-induced apoptosis.
Literature Reference：D.C.Lu et al., Nat. Med., 6, 397 (2000)\nC.Dumanchin-Njock et al., J. Neurochem., 78, 1153 (2001)\nV.Galvan et al., J. Neurochem., 82, 283 (2002)\nY.Chen et al., J. Cell Biol., 163, 27 (2003)\nD.C.Lu et al., J. Neurochem., 87, 733 (2003)
Cas：N/A